Lineage for d1wela1 (1wel A:412-523)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724530Protein RNA-binding protein 12 [143349] (2 species)
    3rd RBD
  7. 724531Species Human (Homo sapiens) [TaxId:9606] [143350] (2 PDB entries)
  8. 724532Domain d1wela1: 1wel A:412-523 [120965]
    1st RBD

Details for d1wela1

PDB Entry: 1wel (more details)

PDB Description: Solution structure of RNA binding domain in NP_006038
PDB Compounds: (A:) RNA-binding protein 12

SCOP Domain Sequences for d1wela1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}
kspsgqkrsrsrspheagfcvylkglpfeaenkhvidffkkldivedsiyiaygpngkat
gegfvefrneadykaalcrhkqymgnrfiqvhpitkkgmlekidmirkrlqs

SCOP Domain Coordinates for d1wela1:

Click to download the PDB-style file with coordinates for d1wela1.
(The format of our PDB-style files is described here.)

Timeline for d1wela1: