Lineage for d1wela1 (1wel A:406-522)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952125Protein RNA-binding protein 12 [143349] (2 species)
    3rd RBD
  7. 2952126Species Human (Homo sapiens) [TaxId:9606] [143350] (3 PDB entries)
    Uniprot Q9NTZ6 412-523! Uniprot Q9NTZ6 536-638
  8. 2952127Domain d1wela1: 1wel A:406-522 [120965]
    Other proteins in same PDB: d1wela2, d1wela3
    1st RBD

Details for d1wela1

PDB Entry: 1wel (more details)

PDB Description: solution structure of rna binding domain in np_006038
PDB Compounds: (A:) RNA-binding protein 12

SCOPe Domain Sequences for d1wela1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wela1 d.58.7.1 (A:406-522) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}
ssgssgkspsgqkrsrsrspheagfcvylkglpfeaenkhvidffkkldivedsiyiayg
pngkatgegfvefrneadykaalcrhkqymgnrfiqvhpitkkgmlekidmirkrlq

SCOPe Domain Coordinates for d1wela1:

Click to download the PDB-style file with coordinates for d1wela1.
(The format of our PDB-style files is described here.)

Timeline for d1wela1: