Lineage for d1we5f2 (1we5 F:1-247)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391701Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (4 proteins)
    Pfam PF16863
  6. 2391718Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species)
  7. 2391719Species Escherichia coli [TaxId:562] [117141] (5 PDB entries)
    Uniprot P31434
  8. 2391749Domain d1we5f2: 1we5 F:1-247 [120962]
    Other proteins in same PDB: d1we5a1, d1we5a3, d1we5a4, d1we5b1, d1we5b3, d1we5b4, d1we5c1, d1we5c3, d1we5c4, d1we5d1, d1we5d3, d1we5d4, d1we5e1, d1we5e3, d1we5e4, d1we5f1, d1we5f3, d1we5f4
    automated match to d2f2ha2
    complexed with mes

Details for d1we5f2

PDB Entry: 1we5 (more details), 2.4 Å

PDB Description: crystal structure of alpha-xylosidase from escherichia coli
PDB Compounds: (F:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1we5f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we5f2 b.30.5.11 (F:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]}
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptp

SCOPe Domain Coordinates for d1we5f2:

Click to download the PDB-style file with coordinates for d1we5f2.
(The format of our PDB-style files is described here.)

Timeline for d1we5f2: