![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily) sandwich; 10 strands in two sheets |
![]() | Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) ![]() |
![]() | Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins) |
![]() | Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117128] (5 PDB entries) Uniprot P31434 |
![]() | Domain d1we5f1: 1we5 F:666-772 [120961] Other proteins in same PDB: d1we5a2, d1we5a3, d1we5a4, d1we5b2, d1we5b3, d1we5b4, d1we5c2, d1we5c3, d1we5c4, d1we5d2, d1we5d3, d1we5d4, d1we5e2, d1we5e3, d1we5e4, d1we5f2, d1we5f3, d1we5f4 automated match to d2f2ha1 complexed with mes |
PDB Entry: 1we5 (more details), 2.4 Å
SCOPe Domain Sequences for d1we5f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we5f1 b.150.1.1 (F:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]} ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
Timeline for d1we5f1: