SCOP 1.73: Domain d1we5e3: 1we5 E:586-665

Lineage for d1we5e3 (1we5 E:586-665)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.4: Putative glucosidase YicI, domain 3 [117298] (1 protein)

6. Protein Putative glucosidase YicI, domain 3 [117299] (1 species)

7. Species Escherichia coli [TaxId:562] [117300] (5 PDB entries)

8. Domain d1we5e3: 1we5 E:586-665 [120959]
   Other proteins in same PDB: d1we5a1, d1we5a2, d1we5a4, d1we5b1, d1we5b2, d1we5b4, d1we5c1, d1we5c2, d1we5c4, d1we5d1, d1we5d2, d1we5d4, d1we5e1, d1we5e2, d1we5e4, d1we5f1, d1we5f2, d1we5f4
   automatically matched to 2F2H A:586-665
   complexed with mes

Details for d1we5e3

PDB Entry: 1we5, 2.4 Å

PDB Description: crystal structure of alpha-xylosidase from escherichia coli

PDB Compounds: (E:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d1we5e3:

Sequence; same for both SEQRES and ATOM records:

>d1we5e3 b.71.1.4 (E:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

Timeline for d1we5e3:

• d1we5e3 is new in SCOP 1.73
  
• d1we5e3 appears in SCOP 1.75
  
• d1we5e3 appears in the current release, SCOPe 2.08