Lineage for d1we5d3 (1we5 D:586-665)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810903Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins)
  6. 2810934Protein Putative glucosidase YicI, domain 3 [117299] (1 species)
  7. 2810935Species Escherichia coli [TaxId:562] [117300] (5 PDB entries)
    Uniprot P31434
  8. 2810963Domain d1we5d3: 1we5 D:586-665 [120955]
    Other proteins in same PDB: d1we5a1, d1we5a2, d1we5a4, d1we5b1, d1we5b2, d1we5b4, d1we5c1, d1we5c2, d1we5c4, d1we5d1, d1we5d2, d1we5d4, d1we5e1, d1we5e2, d1we5e4, d1we5f1, d1we5f2, d1we5f4
    automated match to d2f2ha3
    complexed with mes

Details for d1we5d3

PDB Entry: 1we5 (more details), 2.4 Å

PDB Description: crystal structure of alpha-xylosidase from escherichia coli
PDB Compounds: (D:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1we5d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we5d3 b.71.1.4 (D:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

SCOPe Domain Coordinates for d1we5d3:

Click to download the PDB-style file with coordinates for d1we5d3.
(The format of our PDB-style files is described here.)

Timeline for d1we5d3: