Lineage for d1we5c1 (1we5 C:666-772)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680880Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 680881Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family) (S)
  5. 680882Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein)
  6. 680883Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)
  7. 680884Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
  8. 680911Domain d1we5c1: 1we5 C:666-772 [120949]
    Other proteins in same PDB: d1we5a2, d1we5a3, d1we5a4, d1we5b2, d1we5b3, d1we5b4, d1we5c2, d1we5c3, d1we5c4, d1we5d2, d1we5d3, d1we5d4, d1we5e2, d1we5e3, d1we5e4, d1we5f2, d1we5f3, d1we5f4
    automatically matched to 2F2H A:666-773
    complexed with mes

Details for d1we5c1

PDB Entry: 1we5 (more details), 2.4 Å

PDB Description: crystal structure of alpha-xylosidase from escherichia coli
PDB Compounds: (C:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d1we5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we5c1 b.150.1.1 (C:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl

SCOP Domain Coordinates for d1we5c1:

Click to download the PDB-style file with coordinates for d1we5c1.
(The format of our PDB-style files is described here.)

Timeline for d1we5c1: