Lineage for d1we5a4 (1we5 A:248-585)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832243Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (6 proteins)
    Pfam PF01055
  6. 2832277Protein Putative glucosidase YicI, domain 2 [117373] (1 species)
  7. 2832278Species Escherichia coli [TaxId:562] [117374] (5 PDB entries)
    Uniprot P31434
  8. 2832303Domain d1we5a4: 1we5 A:248-585 [120944]
    Other proteins in same PDB: d1we5a1, d1we5a2, d1we5a3, d1we5b1, d1we5b2, d1we5b3, d1we5c1, d1we5c2, d1we5c3, d1we5d1, d1we5d2, d1we5d3, d1we5e1, d1we5e2, d1we5e3, d1we5f1, d1we5f2, d1we5f3
    automated match to d2f2ha4
    complexed with mes

Details for d1we5a4

PDB Entry: 1we5 (more details), 2.4 Å

PDB Description: crystal structure of alpha-xylosidase from escherichia coli
PDB Compounds: (A:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1we5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we5a4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]}
kavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlplhvfhfdc
fwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkelqekgyll
krpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfgeriptdvqw
fdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwggdcyany
esmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlhgsksyrv
pwayddescdvvrfftqlkcrmmpylyreaaranargt

SCOPe Domain Coordinates for d1we5a4:

Click to download the PDB-style file with coordinates for d1we5a4.
(The format of our PDB-style files is described here.)

Timeline for d1we5a4: