![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins) |
![]() | Protein Putative glucosidase YicI, domain 3 [117299] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117300] (5 PDB entries) Uniprot P31434 |
![]() | Domain d1we5a3: 1we5 A:586-665 [120943] Other proteins in same PDB: d1we5a1, d1we5a2, d1we5a4, d1we5b1, d1we5b2, d1we5b4, d1we5c1, d1we5c2, d1we5c4, d1we5d1, d1we5d2, d1we5d4, d1we5e1, d1we5e2, d1we5e4, d1we5f1, d1we5f2, d1we5f4 automated match to d2f2ha3 complexed with mes |
PDB Entry: 1we5 (more details), 2.4 Å
SCOPe Domain Sequences for d1we5a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we5a3 b.71.1.4 (A:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]} pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld gsrwhkqqhgflslpvyvrd
Timeline for d1we5a3: