![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.2: Shikimate kinase (AroK) [52566] (1 protein) similar to the nucleotide/nucleoside kinases but acts on different substrate |
![]() | Protein Shikimate kinase (AroK) [52567] (4 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [75194] (19 PDB entries) |
![]() | Domain d1we2a1: 1we2 A:2-166 [120940] automatically matched to d1l4ua_ complexed with adp, cl, dhk, mg |
PDB Entry: 1we2 (more details), 2.3 Å
SCOP Domain Sequences for d1we2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we2a1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrl
Timeline for d1we2a1: