Lineage for d1we0e1 (1we0 E:1-166)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 834330Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 834343Protein Alkyl hydroperoxide reductase AhpC [69516] (3 species)
  7. 834344Species Amphibacillus xylanus [TaxId:1449] [142369] (1 PDB entry)
    Uniprot O87200 2-167
  8. 834349Domain d1we0e1: 1we0 E:1-166 [120934]
    automatically matched to 1WE0 A:1-166
    complexed with nh4

Details for d1we0e1

PDB Entry: 1we0 (more details), 2.9 Å

PDB Description: crystal structure of peroxiredoxin (ahpc) from amphibacillus xylanus
PDB Compounds: (E:) alkyl hydroperoxide reductase C

SCOP Domain Sequences for d1we0e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we0e1 c.47.1.10 (E:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]}
sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc

SCOP Domain Coordinates for d1we0e1:

Click to download the PDB-style file with coordinates for d1we0e1.
(The format of our PDB-style files is described here.)

Timeline for d1we0e1: