SCOP 1.75: Domain d1wdza1: 1wdz A:2-228

Lineage for d1wdza1 (1wdz A:2-228)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (4 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.3: IMD domain [140703] (1 protein)
   Pfam PF08397

6. Protein BAP2/IRSp53 N-terminal domain [140704] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140705] (2 PDB entries)
   Uniprot Q9UQB8 1-248! Uniprot Q9UQB8 2-228

8. Domain d1wdza1: 1wdz A:2-228 [120928]

Details for d1wdza1

PDB Entry: 1wdz, 2.63 Å

PDB Description: Crystal structure of RCB domain of IRSp53

PDB Compounds: (A:) insulin receptor substrate p53

SCOP Domain Sequences for d1wdza1:

Sequence; same for both SEQRES and ATOM records:

>d1wdza1 a.238.1.3 (A:2-228) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
slsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmge
lasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalk
kyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvsd
gyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqq

Timeline for d1wdza1:

• d1wdza1 first appeared in SCOP 1.73
  
• d1wdza1 appears in SCOPe 2.01
  
• d1wdza1 appears in the current release, SCOPe 2.08