Lineage for d1wdwk1 (1wdw K:1-247)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681300Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 681489Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)
  6. 681519Protein Trp synthase alpha-subunit [51388] (5 species)
  7. 681520Species Archaeon Pyrococcus furiosus [TaxId:2261] [51390] (2 PDB entries)
  8. 681528Domain d1wdwk1: 1wdw K:1-247 [120926]
    Other proteins in same PDB: d1wdwb1, d1wdwd1, d1wdwf1, d1wdwh1, d1wdwj1, d1wdwl1
    automatically matched to d1geqa_
    complexed with plp

Details for d1wdwk1

PDB Entry: 1wdw (more details), 3 Å

PDB Description: Structural basis of mutual activation of the tryptophan synthase a2b2 complex from a hyperthermophile, Pyrococcus furiosus
PDB Compounds: (K:) tryptophan synthase alpha chain

SCOP Domain Sequences for d1wdwk1:

Sequence, based on SEQRES records: (download)

>d1wdwk1 c.1.2.4 (K:1-247) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay
dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk
kveellg

Sequence, based on observed residues (ATOM records): (download)

>d1wdwk1 c.1.2.4 (K:1-247) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
hakefteiareegiktvflaapntpderlkviddmttgfvylvsaydllrrakricrnkv
avgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkveellg

SCOP Domain Coordinates for d1wdwk1:

Click to download the PDB-style file with coordinates for d1wdwk1.
(The format of our PDB-style files is described here.)

Timeline for d1wdwk1: