Lineage for d1wdwj1 (1wdw J:1-385)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 844422Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 844423Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 844424Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 844592Protein Tryptophan synthase, beta-subunit [53688] (2 species)
  7. 844593Species Archaeon Pyrococcus furiosus [TaxId:2261] [142741] (2 PDB entries)
    Uniprot Q8U093 1-386
  8. 844602Domain d1wdwj1: 1wdw J:1-385 [120925]
    Other proteins in same PDB: d1wdwa1, d1wdwc1, d1wdwe1, d1wdwg1, d1wdwi1, d1wdwk1
    automatically matched to 1V8Z A:1-386
    complexed with plp

Details for d1wdwj1

PDB Entry: 1wdw (more details), 3 Å

PDB Description: Structural basis of mutual activation of the tryptophan synthase a2b2 complex from a hyperthermophile, Pyrococcus furiosus
PDB Compounds: (J:) Tryptophan synthase beta chain 1

SCOP Domain Sequences for d1wdwj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdwj1 c.79.1.1 (J:1-385) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvs

SCOP Domain Coordinates for d1wdwj1:

Click to download the PDB-style file with coordinates for d1wdwj1.
(The format of our PDB-style files is described here.)

Timeline for d1wdwj1: