Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins) |
Protein Tryptophan synthase, beta-subunit [53688] (2 species) |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [142741] (2 PDB entries) Uniprot Q8U093 1-386 |
Domain d1wdwj1: 1wdw J:1-385 [120925] Other proteins in same PDB: d1wdwa1, d1wdwc1, d1wdwe1, d1wdwg1, d1wdwi1, d1wdwk1 automatically matched to 1V8Z A:1-386 complexed with plp |
PDB Entry: 1wdw (more details), 3 Å
SCOP Domain Sequences for d1wdwj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdwj1 c.79.1.1 (J:1-385) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem srdeiiivnlsgrgdkdldivlkvs
Timeline for d1wdwj1: