Lineage for d1wdwh_ (1wdw H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907595Protein Tryptophan synthase, beta-subunit [53688] (4 species)
  7. 2907601Species Pyrococcus furiosus [TaxId:2261] [142741] (2 PDB entries)
    Uniprot Q8U093 1-386
  8. 2907609Domain d1wdwh_: 1wdw H: [120923]
    Other proteins in same PDB: d1wdwa_, d1wdwc_, d1wdwe_, d1wdwg_, d1wdwi_, d1wdwk_
    automated match to d1v8zb_
    complexed with plp

Details for d1wdwh_

PDB Entry: 1wdw (more details), 3 Å

PDB Description: Structural basis of mutual activation of the tryptophan synthase a2b2 complex from a hyperthermophile, Pyrococcus furiosus
PDB Compounds: (H:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d1wdwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdwh_ c.79.1.1 (H:) Tryptophan synthase, beta-subunit {Pyrococcus furiosus [TaxId: 2261]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvs

SCOPe Domain Coordinates for d1wdwh_:

Click to download the PDB-style file with coordinates for d1wdwh_.
(The format of our PDB-style files is described here.)

Timeline for d1wdwh_: