Lineage for d1wdwe_ (1wdw E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2435860Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2435890Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2435908Species Pyrococcus furiosus [TaxId:2261] [51390] (10 PDB entries)
  8. 2435929Domain d1wdwe_: 1wdw E: [120920]
    Other proteins in same PDB: d1wdwb_, d1wdwd_, d1wdwf_, d1wdwh_, d1wdwj_, d1wdwl_
    automated match to d1geqa_
    complexed with plp

Details for d1wdwe_

PDB Entry: 1wdw (more details), 3 Å

PDB Description: Structural basis of mutual activation of the tryptophan synthase a2b2 complex from a hyperthermophile, Pyrococcus furiosus
PDB Compounds: (E:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d1wdwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdwe_ c.1.2.4 (E:) Trp synthase alpha-subunit {Pyrococcus furiosus [TaxId: 2261]}
mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay
dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk
kveellgi

SCOPe Domain Coordinates for d1wdwe_:

Click to download the PDB-style file with coordinates for d1wdwe_.
(The format of our PDB-style files is described here.)

Timeline for d1wdwe_: