![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
![]() | Protein Trp synthase alpha-subunit [51388] (8 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [51390] (10 PDB entries) |
![]() | Domain d1wdwe_: 1wdw E: [120920] Other proteins in same PDB: d1wdwb_, d1wdwd_, d1wdwf_, d1wdwh_, d1wdwj_, d1wdwl_ automated match to d1geqa_ complexed with plp |
PDB Entry: 1wdw (more details), 3 Å
SCOPe Domain Sequences for d1wdwe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdwe_ c.1.2.4 (E:) Trp synthase alpha-subunit {Pyrococcus furiosus [TaxId: 2261]} mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk kveellgi
Timeline for d1wdwe_: