Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
Protein Trp synthase alpha-subunit [51388] (9 species) |
Species Pyrococcus furiosus [TaxId:2261] [51390] (10 PDB entries) |
Domain d1wdwc_: 1wdw C: [120918] Other proteins in same PDB: d1wdwb_, d1wdwd_, d1wdwf_, d1wdwh_, d1wdwj_, d1wdwl_ automated match to d1geqa_ complexed with plp |
PDB Entry: 1wdw (more details), 3 Å
SCOPe Domain Sequences for d1wdwc_:
Sequence, based on SEQRES records: (download)
>d1wdwc_ c.1.2.4 (C:) Trp synthase alpha-subunit {Pyrococcus furiosus [TaxId: 2261]} mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk kveellgi
>d1wdwc_ c.1.2.4 (C:) Trp synthase alpha-subunit {Pyrococcus furiosus [TaxId: 2261]} mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf hakefteiareegiktvflaapntpderlkviddmttgfvylvslyeipktaydllrrak ricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkveellg i
Timeline for d1wdwc_: