Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) |
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins) |
Protein Trp synthase alpha-subunit [51388] (5 species) |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [51390] (2 PDB entries) |
Domain d1wdwa1: 1wdw A:1-247 [120916] Other proteins in same PDB: d1wdwb1, d1wdwd1, d1wdwf1, d1wdwh1, d1wdwj1, d1wdwl1 automatically matched to d1geqa_ complexed with plp |
PDB Entry: 1wdw (more details), 3 Å
SCOP Domain Sequences for d1wdwa1:
Sequence, based on SEQRES records: (download)
>d1wdwa1 c.1.2.4 (A:1-247) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk kveellg
>d1wdwa1 c.1.2.4 (A:1-247) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf hakefteiareegiktvflaapntpderlkviddmttgfvylvslyeeipktaydllrra kricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkveell g
Timeline for d1wdwa1: