![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Elongation factor G (EF-G) [54982] (2 species) domain III is seen in 1FNM but disordered in the most of other PDB entries |
![]() | Species Thermus thermophilus, EF-G-2 [TaxId:274] [143371] (2 PDB entries) Uniprot Q5SI76 371-447! Uniprot Q5SI76 563-658 TTHA1498 |
![]() | Domain d1wdta5: 1wdt A:378-454 [120915] Other proteins in same PDB: d1wdta1, d1wdta2, d1wdta3 complexed with gtp, mg |
PDB Entry: 1wdt (more details), 2.2 Å
SCOPe Domain Sequences for d1wdta5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdta5 d.58.11.1 (A:378-454) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} lpdpnvpvalhpkgrtdearlgealrklleedpslklerqeetgelllwghgelhlatak erlqdygvevefsvpkv
Timeline for d1wdta5:
![]() Domains from same chain: (mouse over for more information) d1wdta1, d1wdta2, d1wdta3, d1wdta4 |