Lineage for d1wdta2 (1wdt A:8-274)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830179Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (2 species)
    has internal nucleotide exchange factor built in as an insertion subdomain
  7. 830191Species Thermus thermophilus, EF-G-2 [TaxId:274] [142226] (2 PDB entries)
    Uniprot Q5SI76 1-267
    TTHA1498
  8. 830193Domain d1wdta2: 1wdt A:8-274 [120912]
    Other proteins in same PDB: d1wdta1, d1wdta3, d1wdta4, d1wdta5
    complexed with gtp, mg

Details for d1wdta2

PDB Entry: 1wdt (more details), 2.2 Å

PDB Description: Crystal structure of ttk003000868 from Thermus thermophilus HB8
PDB Compounds: (A:) elongation factor G homolog

SCOP Domain Sequences for d1wdta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdta2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]}
mirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrttvrtgva
pllfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawtvaerlgl
prmvvvtkldkggdyyalledlrstlgpilpidlplyeggkwvglidvfhgkayryenge
ereaevppeerervqrfrqevleaivetdegllekylegeevtgealekafheavrrgll
ypvalasgereigvlpllelilealps

SCOP Domain Coordinates for d1wdta2:

Click to download the PDB-style file with coordinates for d1wdta2.
(The format of our PDB-style files is described here.)

Timeline for d1wdta2: