SCOPe 2.06: Domain d1wdta1: 1wdt A:275-377

Lineage for d1wdta1 (1wdt A:275-377)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (10 proteins)

6. Protein Elongation factor G (EF-G), domain II [50456] (2 species)

7. Species Thermus thermophilus, EF-G-2 [TaxId:274] [141334] (2 PDB entries)
   Uniprot Q5SI76 268-370
   TTHA1498

8. Domain d1wdta1: 1wdt A:275-377 [120911]
   Other proteins in same PDB: d1wdta2, d1wdta3, d1wdta4, d1wdta5, d1wdta6
   complexed with gtp, mg

Details for d1wdta1

PDB Entry: 1wdt, 2.2 Å

PDB Description: Crystal structure of ttk003000868 from Thermus thermophilus HB8

PDB Compounds: (A:) elongation factor G homolog

SCOPe Domain Sequences for d1wdta1:

Sequence; same for both SEQRES and ATOM records:

>d1wdta1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]}
pterfgdgpplakvfkvqvdpfmgqvaylrlyrgrlkpgdslqseagqvrlphlyvpmgk
dlleveeaeagfvlgvpkaeglhrgmvlwqgekpeseevpfar

Timeline for d1wdta1:

• d1wdta1 first appeared in SCOP 1.73
  
• d1wdta1 appears in SCOPe 2.05
  
• d1wdta1 appears in SCOPe 2.07
  
• d1wdta1 appears in the current release, SCOPe 2.08