Lineage for d1wdsa1 (1wds A:5-495)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818157Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1818350Protein beta-Amylase [51481] (3 species)
    Common fold covers whole protein structure
  7. 1818353Species Soybean (Glycine max) [TaxId:3847] [51482] (18 PDB entries)
    Uniprot P10538
  8. 1818357Domain d1wdsa1: 1wds A:5-495 [120910]
    complexed with glc, so4

Details for d1wdsa1

PDB Entry: 1wds (more details), 1.64 Å

PDB Description: the role of an inner loop in the catalytic mechanism of soybean beta- amylase
PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d1wdsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdsa1 c.1.8.1 (A:5-495) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]}
snmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgp
kqydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifyt
nrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpa
gelrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpes
tgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwyk
venhaaeltagyynlndrdgyrpiarmlsrhhailnfaclemrdseqpsdaksgpqelvq
qvlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrlsdd
llqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfp
wlpetdmkvdg

SCOPe Domain Coordinates for d1wdsa1:

Click to download the PDB-style file with coordinates for d1wdsa1.
(The format of our PDB-style files is described here.)

Timeline for d1wdsa1: