SCOP 1.73: Domain d1wdpa1: 1wdp A:6-495

Lineage for d1wdpa1 (1wdp A:6-495)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein beta-Amylase [51481] (3 species)
   Common fold covers whole protein structure

7. Species Soybean (Glycine max) [TaxId:3847] [51482] (19 PDB entries)

8. Domain d1wdpa1: 1wdp A:6-495 [120907]
   automatically matched to d1bfn__
   complexed with so4

Details for d1wdpa1

PDB Entry: 1wdp, 1.27 Å

PDB Description: The role of an inner loop in the catalytic mechanism of soybean beta-amylase

PDB Compounds: (A:) beta-amylase

SCOP Domain Sequences for d1wdpa1:

Sequence; same for both SEQRES and ATOM records:

>d1wdpa1 c.1.8.1 (A:6-495) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]}
nmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgpk
qydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifytn
rsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpag
elrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpest
gffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwykv
enhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvqq
vlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrlsddl
lqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfpw
lpetdmkvdg

Timeline for d1wdpa1:

• d1wdpa1 is new in SCOP 1.73
  
• d1wdpa1 appears in SCOP 1.75
  
• d1wdpa1 appears in the current release, SCOPe 2.08, called d1wdpa_