Lineage for d1wcqc1 (1wcq C:405-505)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1111680Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1111916Protein Sialidase, "linker" domain [49237] (1 species)
    follows the catalytic six-bladed beta-propeller domain
  7. 1111917Species Micromonospora viridifaciens [TaxId:1881] [49238] (6 PDB entries)
    Uniprot Q02834 47-647
  8. 1111923Domain d1wcqc1: 1wcq C:405-505 [120900]
    Other proteins in same PDB: d1wcqa2, d1wcqa3, d1wcqb2, d1wcqb3, d1wcqc2, d1wcqc3
    automatically matched to d1eut_1
    complexed with dan, gol, na

Details for d1wcqc1

PDB Entry: 1wcq (more details), 2.1 Å

PDB Description: mutagenesis of the nucleophilic tyrosine in a bacterial sialidase to phenylalanine.
PDB Compounds: (C:) sialidase

SCOPe Domain Sequences for d1wcqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcqc1 b.1.18.2 (C:405-505) Sialidase, "linker" domain {Micromonospora viridifaciens [TaxId: 1881]}
capftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqak
gqvtitvpagttpgryrvgatlrtsagnasttftvtvglld

SCOPe Domain Coordinates for d1wcqc1:

Click to download the PDB-style file with coordinates for d1wcqc1.
(The format of our PDB-style files is described here.)

Timeline for d1wcqc1: