Lineage for d1wcqb2 (1wcq B:506-647)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2047120Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2047121Protein automated matches [190770] (37 species)
    not a true protein
  7. 2047385Species Micromonospora viridifaciens [TaxId:1881] [254943] (4 PDB entries)
  8. 2047394Domain d1wcqb2: 1wcq B:506-647 [120898]
    Other proteins in same PDB: d1wcqa1, d1wcqa3, d1wcqb1, d1wcqb3, d1wcqc1, d1wcqc3
    automated match to d1w8oa2
    complexed with dan, gol, na

Details for d1wcqb2

PDB Entry: 1wcq (more details), 2.1 Å

PDB Description: mutagenesis of the nucleophilic tyrosine in a bacterial sialidase to phenylalanine.
PDB Compounds: (B:) sialidase

SCOPe Domain Sequences for d1wcqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcqb2 b.18.1.0 (B:506-647) automated matches {Micromonospora viridifaciens [TaxId: 1881]}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr

SCOPe Domain Coordinates for d1wcqb2:

Click to download the PDB-style file with coordinates for d1wcqb2.
(The format of our PDB-style files is described here.)

Timeline for d1wcqb2: