Lineage for d1wcqb1 (1wcq B:405-505)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658673Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 658895Protein Sialidase, "linker" domain [49237] (1 species)
    follows the catalytic six-bladed beta-propeller domain
  7. 658896Species Micromonospora viridifaciens [TaxId:1881] [49238] (6 PDB entries)
  8. 658901Domain d1wcqb1: 1wcq B:405-505 [120897]
    Other proteins in same PDB: d1wcqa2, d1wcqa3, d1wcqb2, d1wcqb3, d1wcqc2, d1wcqc3
    automatically matched to d1eut_1
    complexed with dan, gol, na; mutant

Details for d1wcqb1

PDB Entry: 1wcq (more details), 2.1 Å

PDB Description: mutagenesis of the nucleophilic tyrosine in a bacterial sialidase to phenylalanine.
PDB Compounds: (B:) sialidase

SCOP Domain Sequences for d1wcqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcqb1 b.1.18.2 (B:405-505) Sialidase, "linker" domain {Micromonospora viridifaciens [TaxId: 1881]}
capftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqak
gqvtitvpagttpgryrvgatlrtsagnasttftvtvglld

SCOP Domain Coordinates for d1wcqb1:

Click to download the PDB-style file with coordinates for d1wcqb1.
(The format of our PDB-style files is described here.)

Timeline for d1wcqb1: