Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (49 species) not a true protein |
Species Micromonospora viridifaciens [TaxId:1881] [254943] (4 PDB entries) |
Domain d1wcqa2: 1wcq A:506-647 [120895] Other proteins in same PDB: d1wcqa1, d1wcqa3, d1wcqb1, d1wcqb3, d1wcqc1, d1wcqc3 automated match to d1w8oa2 complexed with dan, gol, na |
PDB Entry: 1wcq (more details), 2.1 Å
SCOPe Domain Sequences for d1wcqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wcqa2 b.18.1.0 (A:506-647) automated matches {Micromonospora viridifaciens [TaxId: 1881]} qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv alseqtghkyaavaelevegqr
Timeline for d1wcqa2: