Lineage for d1wcqa2 (1wcq A:506-647)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662025Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 662026Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) (S)
  5. 662027Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
  6. 662040Protein Sialidase, C-terminal domain [49789] (1 species)
  7. 662041Species Micromonospora viridifaciens [TaxId:1881] [49790] (6 PDB entries)
  8. 662045Domain d1wcqa2: 1wcq A:506-647 [120895]
    Other proteins in same PDB: d1wcqa1, d1wcqa3, d1wcqb1, d1wcqb3, d1wcqc1, d1wcqc3
    automatically matched to d1eut_2
    complexed with dan, gol, na; mutant

Details for d1wcqa2

PDB Entry: 1wcq (more details), 2.1 Å

PDB Description: mutagenesis of the nucleophilic tyrosine in a bacterial sialidase to phenylalanine.
PDB Compounds: (A:) sialidase

SCOP Domain Sequences for d1wcqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcqa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr

SCOP Domain Coordinates for d1wcqa2:

Click to download the PDB-style file with coordinates for d1wcqa2.
(The format of our PDB-style files is described here.)

Timeline for d1wcqa2: