Lineage for d1wcqa1 (1wcq A:403-505)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766406Species Micromonospora viridifaciens [TaxId:1881] [254942] (4 PDB entries)
  8. 2766414Domain d1wcqa1: 1wcq A:403-505 [120894]
    Other proteins in same PDB: d1wcqa2, d1wcqa3, d1wcqb2, d1wcqb3, d1wcqc2, d1wcqc3
    automated match to d1w8oa1
    complexed with dan, gol, na

Details for d1wcqa1

PDB Entry: 1wcq (more details), 2.1 Å

PDB Description: mutagenesis of the nucleophilic tyrosine in a bacterial sialidase to phenylalanine.
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1wcqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcqa1 b.1.18.0 (A:403-505) automated matches {Micromonospora viridifaciens [TaxId: 1881]}
gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld

SCOPe Domain Coordinates for d1wcqa1:

Click to download the PDB-style file with coordinates for d1wcqa1.
(The format of our PDB-style files is described here.)

Timeline for d1wcqa1: