SCOP 1.73: Domain d1wcla1: 1wcl A:352-421

Lineage for d1wcla1 (1wcl A:352-421)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.2: NusA extra C-terminal domains [109873] (1 protein)

6. Protein Transcription elongation protein NusA [109874] (1 species)

7. Species Escherichia coli [TaxId:562] [109875] (2 PDB entries)

8. Domain d1wcla1: 1wcl A:352-421 [120893]
   automatically matched to d1u9lb_

Details for d1wcla1

PDB Entry: 1wcl

PDB Description: nmr structure of the carboxyterminal domains of escherichia coli nusa

PDB Compounds: (A:) Transcription elongation protein nusA

SCOP Domain Sequences for d1wcla1:

Sequence; same for both SEQRES and ATOM records:

>d1wcla1 a.60.4.2 (A:352-421) Transcription elongation protein NusA {Escherichia coli [TaxId: 562]}
ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
nalatiaqaq

Timeline for d1wcla1:

• d1wcla1 is new in SCOP 1.73
  
• d1wcla1 appears in SCOP 1.75
  
• d1wcla1 appears in the current release, SCOPe 2.08, called d1wcla_