![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.4.2: NusA extra C-terminal domains [109873] (2 proteins) |
![]() | Protein automated matches [254443] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [254940] (1 PDB entry) |
![]() | Domain d1wcla_: 1wcl A: [120893] automated match to d1u9lb_ |
PDB Entry: 1wcl (more details)
SCOPe Domain Sequences for d1wcla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wcla_ a.60.4.2 (A:) automated matches {Escherichia coli [TaxId: 562]} eahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrera knalatiaqaqeeslg
Timeline for d1wcla_: