Lineage for d1wcla_ (1wcl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324209Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2324537Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2324573Family a.60.4.2: NusA extra C-terminal domains [109873] (2 protein domains)
  6. 2324578Protein automated matches [254443] (1 species)
    not a true protein
  7. 2324579Species Escherichia coli [TaxId:562] [254940] (1 PDB entry)
  8. 2324580Domain d1wcla_: 1wcl A: [120893]
    automated match to d1u9lb_

Details for d1wcla_

PDB Entry: 1wcl (more details)

PDB Description: nmr structure of the carboxyterminal domains of escherichia coli nusa
PDB Compounds: (A:) Transcription elongation protein nusA

SCOPe Domain Sequences for d1wcla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcla_ a.60.4.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
eahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrera
knalatiaqaqeeslg

SCOPe Domain Coordinates for d1wcla_:

Click to download the PDB-style file with coordinates for d1wcla_.
(The format of our PDB-style files is described here.)

Timeline for d1wcla_: