Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module automatically mapped to Pfam PF02779 |
Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [88743] (23 PDB entries) Uniprot P21953 52-392 |
Domain d1wcib1: 1wci B:2-204 [120891] Other proteins in same PDB: d1wcia_, d1wcib2 automated match to d1v16b1 complexed with cl, gol, k, mn, wwf |
PDB Entry: 1wci (more details), 1.84 Å
SCOPe Domain Sequences for d1wcib1:
Sequence, based on SEQRES records: (download)
>d1wcib1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} ahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglr dkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrs gdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscied knpciffepkilyraaaeevpie
>d1wcib1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} ahftfqeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkd rvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfnc gsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpcif fepkilyraaaeevpie
Timeline for d1wcib1: