Lineage for d1wcga1 (1wcg A:3-464)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083068Protein Thioglucosidase [141786] (1 species)
  7. 2083069Species Cabbage aphid (Brevicoryne brassicae) [TaxId:69196] [141787] (1 PDB entry)
    Uniprot Q95X01 3-464
  8. 2083070Domain d1wcga1: 1wcg A:3-464 [120888]
    complexed with gol

Details for d1wcga1

PDB Entry: 1wcg (more details), 1.1 Å

PDB Description: aphid myrosinase
PDB Compounds: (A:) thioglucosidase

SCOPe Domain Sequences for d1wcga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]}
ykfpkdfmfgtstasyqieggwnedgkgeniwdrlvhtspevikdgtngdiacdsyhkyk
edvaiikdlnlkfyrfsiswariapsgvmnslepkgiayynnlinelikndiiplvtmyh
wdlpqylqdlggwvnpimsdyfkeyarvlftyfgdrvkwwitfnepiavckgysikayap
nlnlkttghylaghtqliahgkayrlyeemfkptqngkisisisgvffmpknaesdddie
taeranqfergwfghpvykgdyppimkkwvdqkskeeglpwsklpkftkdeikllkgtad
fyalnhyssrlvtfgsdpnpnfnpdasyvtsvdeawlkpnetpyiipvpeglrklliwlk
neygnpqllitengygddgqlddfekisylknylnatlqamyedkcnvigytvwslldnf
ewfygysihfglvkidfndpqrtrtkresytyfknvvstgkp

SCOPe Domain Coordinates for d1wcga1:

Click to download the PDB-style file with coordinates for d1wcga1.
(The format of our PDB-style files is described here.)

Timeline for d1wcga1: