Lineage for d1wcdj1 (1wcd J:11-431)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822486Family b.121.4.9: Birnaviridae-like VP [141109] (2 proteins)
    dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses; includes Pfam PF01766; Birnavirus VP2 protein
  6. 2822487Protein Birnavirus VP2 [141110] (1 species)
    Link between +sRNA and dsRNA viruses two domains - the first similar to (88633) and the second, insert domain is similar to (49818). dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses
  7. 2822488Species Infectious bursal disease virus [TaxId:10995] [141111] (3 PDB entries)
    Uniprot P15480 11-431! Uniprot P61825 8-440! Uniprot Q6S9I7 11-429
  8. 2822491Domain d1wcdj1: 1wcd J:11-431 [120887]

Details for d1wcdj1

PDB Entry: 1wcd (more details), 3 Å

PDB Description: crystal structure of ibdv t1 virus-like particle reveals a missing link in icosahedral viruses evolution
PDB Compounds: (J:) major structural protein vp2

SCOPe Domain Sequences for d1wcdj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcdj1 b.121.4.9 (J:11-431) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]}
ivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivga
hytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfq
gslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigld
pkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrt
svhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsikl
eivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsn
felipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmeva
d

SCOPe Domain Coordinates for d1wcdj1:

Click to download the PDB-style file with coordinates for d1wcdj1.
(The format of our PDB-style files is described here.)

Timeline for d1wcdj1: