SCOP 1.75: Domain d1wcbl1: 1wcb L:1-107

Lineage for d1wcbl1 (1wcb L:1-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d1wcbl1: 1wcb L:1-107 [120884]
   Other proteins in same PDB: d1wcba2, d1wcbb1, d1wcbb2, d1wcbh1, d1wcbh2, d1wcbl2
   automatically matched to d1dqdl1
   complexed with iod, pe1

Details for d1wcbl1

PDB Entry: 1wcb, 2.5 Å

PDB Description: plp-dependent catalytic antibody 15a9 in complex with its hapten

PDB Compounds: (L:) fab fragment of catalytic antibody 15a9, light chain

SCOP Domain Sequences for d1wcbl1:

Sequence; same for both SEQRES and ATOM records:

>d1wcbl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelk

Timeline for d1wcbl1:

• d1wcbl1 first appeared in SCOP 1.73
  
• d1wcbl1 appears in SCOPe 2.01
  
• d1wcbl1 appears in the current release, SCOPe 2.08