Lineage for d1wcba1 (1wcb A:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520831Domain d1wcba1: 1wcb A:1-107 [120882]
    Other proteins in same PDB: d1wcba2, d1wcbb1, d1wcbb2, d1wcbh1, d1wcbh2, d1wcbl2
    automated match to d1a5fl1
    complexed with iod, pe1

Details for d1wcba1

PDB Entry: 1wcb (more details), 2.5 Å

PDB Description: plp-dependent catalytic antibody 15a9 in complex with its hapten
PDB Compounds: (A:) fab fragment of catalytic antibody 15a9, light chain

SCOPe Domain Sequences for d1wcba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcba1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelk

SCOPe Domain Coordinates for d1wcba1:

Click to download the PDB-style file with coordinates for d1wcba1.
(The format of our PDB-style files is described here.)

Timeline for d1wcba1: