| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (17 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
| Domain d1wc7l2: 1wc7 L:108-213 [120881] Other proteins in same PDB: d1wc7a1, d1wc7b1, d1wc7b2, d1wc7h1, d1wc7h2, d1wc7l1 automated match to d1tqbc2 complexed with iod, pp3 |
PDB Entry: 1wc7 (more details), 2.33 Å
SCOPe Domain Sequences for d1wc7l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wc7l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d1wc7l2: