Lineage for d1wc7l2 (1wc7 L:108-213)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364117Domain d1wc7l2: 1wc7 L:108-213 [120881]
    Other proteins in same PDB: d1wc7a1, d1wc7b1, d1wc7b2, d1wc7h1, d1wc7h2, d1wc7l1
    automated match to d1tqbc2
    complexed with iod, pp3

Details for d1wc7l2

PDB Entry: 1wc7 (more details), 2.33 Å

PDB Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-l-alanine
PDB Compounds: (L:) fab fragment of catalytic antibody 15a9, light chain

SCOPe Domain Sequences for d1wc7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wc7l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d1wc7l2:

Click to download the PDB-style file with coordinates for d1wc7l2.
(The format of our PDB-style files is described here.)

Timeline for d1wc7l2: