SCOP 1.75: Domain d1wc7l1: 1wc7 L:1-107

Lineage for d1wc7l1 (1wc7 L:1-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d1wc7l1: 1wc7 L:1-107 [120880]
   Other proteins in same PDB: d1wc7a2, d1wc7b1, d1wc7b2, d1wc7h1, d1wc7h2, d1wc7l2
   automatically matched to d1dqdl1
   complexed with iod, pp3

Details for d1wc7l1

PDB Entry: 1wc7, 2.33 Å

PDB Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-l-alanine

PDB Compounds: (L:) fab fragment of catalytic antibody 15a9, light chain

SCOP Domain Sequences for d1wc7l1:

Sequence; same for both SEQRES and ATOM records:

>d1wc7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelk

Timeline for d1wc7l1:

• d1wc7l1 first appeared in SCOP 1.73
  
• d1wc7l1 appears in SCOPe 2.01
  
• d1wc7l1 appears in the current release, SCOPe 2.08