SCOP 1.73: Domain d1wc7a2: 1wc7 A:108-214

Lineage for d1wc7a2 (1wc7 A:108-214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1wc7a2: 1wc7 A:108-214 [120879]
   Other proteins in same PDB: d1wc7a1, d1wc7l1
   automatically matched to d1dqdl2
   complexed with iod, pp3

Details for d1wc7a2

PDB Entry: 1wc7, 2.33 Å

PDB Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-l-alanine

PDB Compounds: (A:) fab fragment of catalytic antibody 15a9, light chain

SCOP Domain Sequences for d1wc7a2:

Sequence; same for both SEQRES and ATOM records:

>d1wc7a2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1wc7a2:

• d1wc7a2 is new in SCOP 1.73
  
• d1wc7a2 appears in SCOP 1.75
  
• d1wc7a2 appears in the current release, SCOPe 2.08