Lineage for d1wbzd_ (1wbz D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1105903Protein beta2-microglobulin [88600] (5 species)
  7. 1106406Species Mouse (Mus musculus) [TaxId:10090] [88603] (150 PDB entries)
    Uniprot P01887
  8. 1106461Domain d1wbzd_: 1wbz D: [120877]
    Other proteins in same PDB: d1wbza1, d1wbza2, d1wbzc1, d1wbzc2
    automated match to d1bz9b_

Details for d1wbzd_

PDB Entry: 1wbz (more details), 2 Å

PDB Description: crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
PDB Compounds: (D:) beta-2microglobulin

SCOPe Domain Sequences for d1wbzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbzd_ b.1.1.2 (D:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1wbzd_:

Click to download the PDB-style file with coordinates for d1wbzd_.
(The format of our PDB-style files is described here.)

Timeline for d1wbzd_: