![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein beta2-microglobulin [88600] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries) |
![]() | Domain d1wbzd1: 1wbz D:1-99 [120877] Other proteins in same PDB: d1wbza1, d1wbza2, d1wbzc1, d1wbzc2 automatically matched to d1bz9b_ |
PDB Entry: 1wbz (more details), 2 Å
SCOP Domain Sequences for d1wbzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbzd1 b.1.1.2 (D:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1wbzd1: