Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (20 PDB entries) |
Domain d1wbzc2: 1wbz C:3-180 [120876] Other proteins in same PDB: d1wbza1, d1wbzb_, d1wbzc1, d1wbzd_ automatically matched to d1ddha2 |
PDB Entry: 1wbz (more details), 2 Å
SCOPe Domain Sequences for d1wbzc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbzc2 d.19.1.1 (C:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]} hslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeywer etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
Timeline for d1wbzc2:
View in 3D Domains from other chains: (mouse over for more information) d1wbza1, d1wbza2, d1wbzb_, d1wbzd_ |