Lineage for d1wbzc2 (1wbz C:3-180)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719630Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (15 PDB entries)
  8. 719637Domain d1wbzc2: 1wbz C:3-180 [120876]
    Other proteins in same PDB: d1wbza1, d1wbzb1, d1wbzc1, d1wbzd1
    automatically matched to d1ddha2

Details for d1wbzc2

PDB Entry: 1wbz (more details), 2 Å

PDB Description: crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
PDB Compounds: (C:) h-2 class I histocompatibility antigen, k-b alpha chain precursor

SCOP Domain Sequences for d1wbzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbzc2 d.19.1.1 (C:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeywer
etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd
yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll

SCOP Domain Coordinates for d1wbzc2:

Click to download the PDB-style file with coordinates for d1wbzc2.
(The format of our PDB-style files is described here.)

Timeline for d1wbzc2: