SCOP 1.75: Domain d1wbyb1: 1wby B:1-99

Lineage for d1wbyb1 (1wby B:1-99)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
   Uniprot P01887

8. Domain d1wbyb1: 1wby B:1-99 [120871]
   Other proteins in same PDB: d1wbya1, d1wbya2
   automatically matched to d1bz9b_

Details for d1wbyb1

PDB Entry: 1wby, 2.3 Å

PDB Description: crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance

PDB Compounds: (B:) beta-2microglobulin

SCOP Domain Sequences for d1wbyb1:

Sequence; same for both SEQRES and ATOM records:

>d1wbyb1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1wbyb1:

• d1wbyb1 first appeared in SCOP 1.73
  
• d1wbyb1 is called d1wbyb_ in SCOPe 2.01
  
• d1wbyb1 appears in the current release, SCOPe 2.08, called d1wbyb_