SCOPe 2.07: Domain d1wbya2: 1wby A:3-180

Lineage for d1wbya2 (1wby A:3-180)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)

8. Domain d1wbya2: 1wby A:3-180 [120870]
   Other proteins in same PDB: d1wbya1, d1wbyb_
   automatically matched to d1ddha2

Details for d1wbya2

PDB Entry: 1wby, 2.3 Å

PDB Description: crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1wbya2:

Sequence; same for both SEQRES and ATOM records:

>d1wbya2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

Timeline for d1wbya2:

• d1wbya2 first appeared in SCOP 1.73
  
• d1wbya2 appears in SCOPe 2.06
  
• d1wbya2 appears in the current release, SCOPe 2.08