Lineage for d1wbya2 (1wby A:3-180)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1641840Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1642202Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (20 PDB entries)
  8. 1642217Domain d1wbya2: 1wby A:3-180 [120870]
    Other proteins in same PDB: d1wbya1, d1wbyb_
    automatically matched to d1ddha2

Details for d1wbya2

PDB Entry: 1wby (more details), 2.3 Å

PDB Description: crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1wbya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbya2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

SCOPe Domain Coordinates for d1wbya2:

Click to download the PDB-style file with coordinates for d1wbya2.
(The format of our PDB-style files is described here.)

Timeline for d1wbya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wbya1
View in 3D
Domains from other chains:
(mouse over for more information)
d1wbyb_