Lineage for d1wbya1 (1wby A:182-274)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2747150Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
    Uniprot P01901 22-299
  8. 2747205Domain d1wbya1: 1wby A:182-274 [120869]
    Other proteins in same PDB: d1wbya2, d1wbyb_
    automatically matched to d1ddha1

Details for d1wbya1

PDB Entry: 1wby (more details), 2.3 Å

PDB Description: crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1wbya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbya1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOPe Domain Coordinates for d1wbya1:

Click to download the PDB-style file with coordinates for d1wbya1.
(The format of our PDB-style files is described here.)

Timeline for d1wbya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wbya2
View in 3D
Domains from other chains:
(mouse over for more information)
d1wbyb_