SCOPe 2.08: Domain d1wbxb_: 1wbx B:

Lineage for d1wbxb_ (1wbx B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d1wbxb_: 1wbx B: [120868]
   Other proteins in same PDB: d1wbxa1, d1wbxa2
   automated match to d1bz9b_

Details for d1wbxb_

PDB Entry: 1wbx, 1.9 Å

PDB Description: crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance

PDB Compounds: (B:) beta-2microglobulin

SCOPe Domain Sequences for d1wbxb_:

Sequence; same for both SEQRES and ATOM records:

>d1wbxb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1wbxb_:

• d1wbxb_ first appeared in SCOP 1.73, called d1wbxb1
  
• d1wbxb_ appears in SCOPe 2.07