Lineage for d1wbwa1 (1wbw A:5-352)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874963Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 874964Species Human (Homo sapiens) [TaxId:9606] [56130] (60 PDB entries)
  8. 875003Domain d1wbwa1: 1wbw A:5-352 [120865]
    automatically matched to d1a9u__
    complexed with li4

Details for d1wbwa1

PDB Entry: 1wbw (more details), 2.41 Å

PDB Description: identification of novel p38 alpha map kinase inhibitors using fragment-based lead generation.
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOP Domain Sequences for d1wbwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbwa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

SCOP Domain Coordinates for d1wbwa1:

Click to download the PDB-style file with coordinates for d1wbwa1.
(The format of our PDB-style files is described here.)

Timeline for d1wbwa1: