SCOPe 2.07: Domain d1wbsa_: 1wbs A:

Lineage for d1wbsa_ (1wbs A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)

8. Domain d1wbsa_: 1wbs A: [120860]
   automated match to d1a9u__
   complexed with gol, li2

Details for d1wbsa_

PDB Entry: 1wbs, 1.8 Å

PDB Description: identification of novel p38 alpha map kinase inhibitors using fragment-based lead generation.

PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d1wbsa_:

Sequence; same for both SEQRES and ATOM records:

>d1wbsa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldq

Timeline for d1wbsa_:

• d1wbsa_ first appeared in SCOP 1.73, called d1wbsa1
  
• d1wbsa_ appears in SCOPe 2.06
  
• d1wbsa_ appears in the current release, SCOPe 2.08